Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot - Anti-PML Protein Picoband Antibody
PML Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Mouse |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662365-100
Catalog Number: LS-C662365
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PML antibody LS-C662365 is an unconjugated rabbit polyclonal antibody to mouse PML. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- PP8675 | Promyelocytic leukemia | Protein PML | TRIM19 | PML | Promyelocytic leukemia protein | RING finger protein 71 | MYL | RNF71
- UniProt Number
- P29590
- NCBI GenBank
- NM_002675 | NP_002666.1
- SwissProt
- P29590
Target
- Target
- Mouse PML
- Antigen Species
- Mouse
- Gene Name
- PML
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of mouse PML Protein (140-177 aa LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN), different from the related human sequence by six amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
