
Western blot testing of 1) rat heart and 2) mouse heart lysate with PMEL17 antibody at 0.5ug/ml. Predicted molecular weight: ~70 kDa (unmodified), ~100 kDa (glycosylated).
PMEL / SILV / gp100 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782847-100
Catalog Number: LS-C782847
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Gp100 antibody LS-C782847 is an unconjugated rabbit polyclonal antibody to gp100 (PMEL / SILV) from mouse. It is reactive with mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- gp100 | Melanocyte protein PMEL | Me20m/me20s | p100 | PMEL17 | Premelanosome protein | SIL | Silver homolog (mouse) | Silver, mouse, homolog of | Silver locus protein homolog | ME20-M | Me20-m/me20-s | ME20M | Melanocyte protein mel 17 | Melanocyte protein Pmel 17 | PMEL | Silver (mouse homolog) like | D12S53E | ME20 | Melanosomal matrix protein17 | SILV
- UniProt Number
- P40967
- NCBI GenBank
- NM_006928 | NP_008859.1
- SwissProt
- P40967
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Mouse PMEL / SILV / gp100
- Antigen Species
- Mouse
- Gene Name
- PMEL
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids KVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLD were used as the immunogen for the PMEL17 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- 1X PBS
