PLN antibody Western blot. All lanes: Anti PLN at 0.5 ug/ml. Lane 1: Mouse Cardiac Muscle Tissue Lysate at 50 ug. Lane 2: Rat Cardiac Muscle Tissue Lysate at 50 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: K562 Whole Cell Lysate at 40 ug. Predicted band size: 6 kD. Observed band size: 18, 24, 36 kD.
PLN / Phospholamban Antibody (aa1-35)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C357570-100
Catalog Number: LS-C357570
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Phospholamban antibody LS-C357570 is an unconjugated rabbit polyclonal antibody to Phospholamban (PLN) (aa1-35) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CMD1P | CMH18 | PLB | Cardiac phospholamban | Phospholamban | PLN
- UniProt Number
- P26678
- NCBI GenBank
- NM_002667 | NP_002658.1
- SwissProt
- P26678
Target
- Target
- Human PLN / Phospholamban
- Antigen Species
- Human
- Epitope
- Heart muscle (at protein level). .
- Gene Name
- PLN
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human PLN(1-35 aa MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINF), different from the related mouse and rat sequences by one amino acid.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Concentration
- 0.5 mg/mL
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl