
Western blot testing of 1) rat liver, 2) mouse kidney and 3) human HeLa lysate with Perilipin 3 antibody at 0.5ug/ml. Predicted molecular weight ~47 kDa.
PLIN3 / M6PRBP1 / TIP47 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781784-100
Catalog Number: LS-C781784
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TIP47 antibody LS-C781784 is an unconjugated rabbit polyclonal antibody to TIP47 (PLIN3 / M6PRBP1) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 47 kDa MPR-binding protein | Cargo selection protein TIP47 | Perilipin 3 | Placental protein 17 | PLIN3 | PP17 | M6PRBP1 | TIP47 | Perilipin-3
- NCBI GenBank
- NM_005817
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 1 - 2 µg/ml |
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human PLIN3 / M6PRBP1 / TIP47
- Antigen Species
- Human
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids ESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQARRQ were used as the immunogen for the Perilipin 3 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at 4°C. After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
