Western blot analysis of extracts of K562 cells, using PLA2G10 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

PLA2G10 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human
Format:	Liquid

$281.00each

Catalog Number: LS-C496964-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: PLA2G10 antibody LS-C496964 is an unconjugated rabbit polyclonal antibody to human PLA2G10. Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: GX sPLA2 | GXPLA2 | GXSPLA2 | Phospholipase A2, group X | PLA2G10 | SPLA2 | SPLA2-X
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: O15496
NCBI GenBank: NM_003561 | NP_003552.1
SwissProt: O15496

Target

Target: Human PLA2G10
Antigen Species: Human
Gene Name: PLA2G10

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PLA2G10 (NP_003552.1). TVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYL
Immunogen Type: Synthetic Peptide (Linear)