Western blot analysis of extracts of various cell lines.
PKD3 / PRKD3 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C346225-20
Catalog Number: LS-C346225
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PRKD3 antibody LS-C346225 is an unconjugated rabbit polyclonal antibody to PRKD3 (PKD3) from human. It is reactive with human and mouse. Validated for IF, IHC and WB.
- Application
- IF, IHC, WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- EPK2 | PKC-NU | Pkcn | Protein kinase C, nu | Protein kinase EPK2 | PRKCN | Protein kinase C nu | Protein kinase C nu type | NPKC-NU | Pkcnu | PKD3 | PRKD3 | Protein kinase D3
- Recommended Dilution: IF/ICC
- 1:50 - 1:100
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- O94806
- NCBI GenBank
- NM_005813 | NP_005804.1
- SwissProt
- O94806
Target
- Target
- Human PKD3 / PRKD3
- Antigen Species
- Human
- Epitope
- Human PKD3 / PRKD3
- Gene Name
- PRKD3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PRKD3 (NP_005804.1). MSANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTVSFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPEC
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS