PIM1 antibody Western blot. All lanes: Anti PIM1 at 0.5 ug/ml. Lane 1: U20S Whole Cell Lysate at 40 ug. Lane 2: A549 Whole Cell Lysate at 40 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: SW620 Whole Cell Lysate at 40 ug. Lane 5: JURKAT Whole Cell Lysate at 40 ug. Predicted band size: 45 kD. Observed band size: 45 kD.
PIM1 / Pim-1 Antibody (aa373-404)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Horse, Human, Non-Human Primate, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C357504-100
Catalog Number: LS-C357504
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Pim-1 antibody LS-C357504 is an unconjugated rabbit polyclonal antibody to Pim-1 (PIM1) (aa373-404) from human. It is reactive with human, chimpanzee, gibbon and other species. Validated for WB.
- Application
- WB
- Reactivity
- Hr, Hu, NHP, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Pim-1 kinase 44 kDa isoform | Proviral integration site 1 | PIM1 | Oncogene PIM1 | PIM | Pim-1 | Pim-1 oncogene
- UniProt Number
- P11309
- NCBI GenBank
- NM_002648 | NP_002639.1
- SwissProt
- P11309
Target
- Target
- Human PIM1 / Pim-1
- Antigen Species
- Human
- Epitope
- Expressed primarily in cells of the hematopoietic and germline lineages. Isoform 1 and isoform 2 are both expressed in prostate cancer cell lines. .
- Gene Name
- PIM1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human PIM1(373-404 aa EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK), different from the related mouse sequence by seven amino acids and from the related rat sequence by two amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Concentration
- 0.5 mg/mL
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl