Western blot testing of PIM-1 antibody and human samples 1: U20S; 2: A549; 3: COLO320; 4: SW620; 5: Jurkat. Predicted/observed size ~45KD
PIM1 / Pim-1 Antibody (aa282-312)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Bovine, Dog, Horse, Human, Pig, Rabbit, Sheep |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C389082-100
Catalog Number: LS-C389082
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Pim-1 antibody LS-C389082 is an unconjugated rabbit polyclonal antibody to Pim-1 (PIM1) (aa282-312) from human. It is reactive with human, bovine, dog and other species. Validated for WB.
- Application
- WB
- Reactivity
- Bov, Can, Hr, Hu, Por, Rb, Sh
- Predicted Reactivity
- Hamster, Rat
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Pim-1 kinase 44 kDa isoform | Proviral integration site 1 | PIM1 | Oncogene PIM1 | PIM | Pim-1 | Pim-1 oncogene
- UniProt Number
- P11309
- NCBI GenBank
- NM_002648 | NP_002639.1
- SwissProt
- P11309
Target
- Target
- Human PIM1 / Pim-1
- Antigen Species
- Human
- Epitope
- Human PIM1 / Pim-1
- Gene Name
- PIM1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Synthetic peptide from the C-Terminus of human PIM1 (EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK). Percent identity by BLAST analysis: Human, Ferret, Sheep, Cat, Bovine, Rabbit, Horse, Pig, Dog (100%); Rat, Elephant (94%); Hamster (90%); Guinea pig (87%); Opossum (84%); Mouse (77%).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Prior to reconstitution, 4°C. Following reconstitution store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS