
Western blot - Anti-PIK3CB/Pi 3 Kinase P110 Beta Picoband Antibody
PIK3CB / PI3K Beta Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662063-100
Catalog Number: LS-C662063
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PI3K Beta antibody LS-C662063 is an unconjugated rabbit polyclonal antibody to human PI3K Beta (PIK3CB). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- PI3-kinase p110 subunit beta | PI3K | PI3KCB | PI3K-beta | PIK3C1 | PIK3CB | PtdIns-3-kinase p110 | p110BETA | PI3-kinase subunit beta | PI3KBETA | PtdIns-3-kinase subunit beta
- UniProt Number
- P42338
- NCBI GenBank
- NM_006219 | NP_006210.1
- SwissProt
- P42338
Target
- Target
- Human PIK3CB / PI3K Beta
- Antigen Species
- Human
- Epitope
- Expressed ubiquitously.
- Gene Name
- PIK3CB
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human PIK3CB (556-598 aa DLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIW), different from the related mouse and rat sequences by one amino acid.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
