PIGR antibody Western blot. All lanes: Anti PIGR at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: SKOV Whole Cell Lysate at 40 ug. Lane 3: MCF-7 Whole Cell Lysate at 40 ug. Lane 4: SW620 Whole Cell Lysate at 40 ug. Predicted band size: 83 kD. Observed band size: 83 kD.

PIGR Antibody (aa579-613)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human
Format:	Lyophilized

$480.00each

Catalog Number: LS-C407988-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: PIGR antibody LS-C407988 is an unconjugated rabbit polyclonal antibody to human PIGR (aa579-613). Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Poly-Ig receptor | PIGR
UniProt Number: P01833
NCBI GenBank: NM_002644 | NP_002635.2
SwissProt: P01833

Target

Target: Human PIGR
Antigen Species: Human
Gene Name: PIGR

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human PIGR (579-613 aa DAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVAD), different from the related rat sequence by eighteen amino acids.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl