Western blot analysis of PIAS4 expression in rat testis extract, mouse testis extract and HELA whole cell lysates. PIAS4 at 57KD was detected using rabbit anti-PIAS4 Antigen Affinity purified polyclonal antibody at 0.5 ug/ml. The blot was developed using chemiluminescence (ECL) method.
PIAS4 / PIASY Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662362-100
Catalog Number: LS-C662362
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PIASY antibody LS-C662362 is an unconjugated rabbit polyclonal antibody to human PIASY (PIAS4). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- E3 SUMO-protein ligase PIAS4 | PIAS-gamma | ZMIZ6 | PIAS4 | Piasg | PIASY
- UniProt Number
- Q8N2W9
- NCBI GenBank
- NM_015897 | NP_056981.2
- SwissProt
- Q8N2W9
Target
- Target
- Human PIAS4 / PIASY
- Antigen Species
- Human
- Epitope
- Highly expressed in testis and, at lower levels, in spleen, prostate, ovary, colon and peripheral blood leukocytes. .
- Gene Name
- PIAS4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human PIAS4 (130-174 aa EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE), different from the related mouse sequence by two amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl