Western blot testing of human 1) HeLa, 2) U-87 MG, 3) COLO320, 4) HepG2, 5) rat brain and 6) mouse NIH3T3 lysate with PIAS3 antibody at 0.5ug/ml. Predicted molecular weight ~68 kDa.

PIAS3 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782070-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: PIAS3 antibody LS-C782070 is an unconjugated rabbit polyclonal antibody to PIAS3 from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: E3 SUMO-protein ligase PIAS3 | PIAS3 | ZMIZ5
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: Q9Y6X2
NCBI GenBank: NM_006099 | NP_006090.2
SwissProt: Q9Y6X2

Target

Target: Human PIAS3
Antigen Species: Human
Gene Name: PIAS3

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids QRFEEAHFTFALTPQQVQQILTSREVLPGAKCDYTIQVQLRF from the human protein were used as the immunogen for the PIAS3 antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS