
Immunohistochemistry of paraffin-embedded rat lung using PI3 antibody at dilution of 1:100 (40x lens).
PI3 / Elafin Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C747580-20
Catalog Number: LS-C747580
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Elafin antibody LS-C747580 is an unconjugated rabbit polyclonal antibody to Elafin (PI3) from human. It is reactive with human and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Cementoin | Elafin | Elastase-specific inhibitor | ESI | PI-3 | PI3 | Protease inhibitor WAP3 | Trappin-2 | Peptidase inhibitor 3 | Protease inhibitor 3 | SKALP | WAP3 | WFDC14 | Pre-elafin
- UniProt Number
- P19957
- NCBI GenBank
- NM_002638 | NP_002629.1
- SwissProt
- P19957
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC | 1:50 - 1:200 |
| WB | 1:500 - 1:2000 |
Target
- Target
- Human PI3 / Elafin
- Antigen Species
- Human
- Gene Name
- PI3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 23-117 of human PI3 (NP_002629.1). AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
