Western blot analysis of extracts of various cell lines, using PERP antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

PERP Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse
Format:	Liquid

$281.00each

Catalog Number: LS-C750471-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: PERP antibody LS-C750471 is an unconjugated rabbit polyclonal antibody to PERP from human. It is reactive with human and mouse. Validated for WB.
Application: WB
Reactivity: Hu, Ms
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: DJ496H19.1 | KCP-1 | PERP, TP53 apoptosis effector | PERP | KCP1 | p53-induced protein PIGPC1 | THW | KRTCAP1 | PIGPC1 | RP3-496H19.1 | Transmembrane protein THW
Recommended Dilution: WB: 1:200 - 1:2000
UniProt Number: Q96FX8
NCBI GenBank: NM_022121 | NP_071404.2
SwissProt: Q96FX8

Target

Target: Human PERP
Antigen Species: Human
Gene Name: PERP

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-Terminus of human PERP (NP_071404.2). CGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA
Immunogen Type: Synthetic Peptide (Linear)