HLA-F Antibody
Catalog Number: LS-C680599
2 sizes / from $300.00
Antibody: Rabbit Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay, Immunofluorescence
Reactivity: Human
Format: Liquid
Peptide F Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay |
| Reactivity: | Bovine |
| Format: | Lyophilized |
$896.00each
Catalog Number: LS-C144099-400
Catalog Number: LS-C144099
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Peptide F antibody LS-C144099 is an unconjugated rabbit polyclonal antibody to bovine Peptide F. Validated for ELISA.
- Application
- ELISA
- Reactivity
- Bov
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- PENK | Preproenkephalin | Bovine Peptide F | YGGFMKKMDELYPLEVEEEANGGEVLGKRYGGFM | C172H259N41O53S3
Target
- Target
- Bovine Peptide F
- Antigen Species
- Bovine
- Epitope
- Bovine Peptide F.
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Synthetic peptide corresponding to bovine Peptide F
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized
- Preservative
- No
- Purification Method
- Other
Storage & Handling
- Storage Conditions
- Lyophilized powder may be stored at -20°C. Stable for 1 year at -20°C. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Reconstituted product is stable for 1 year at -20°C.
