Western blot testing of human 1) HeLa, 2) placenta, 3) HepG2, 4) MCF7, 5) mouse testis and 6) mouse brain lysate with RKIP antibody at 0.5ug/ml. Predicted molecular weight ~21 kDa.
PEBP1 / RKIP Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782117-100
Catalog Number: LS-C782117
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- RKIP antibody LS-C782117 is an unconjugated rabbit polyclonal antibody to RKIP (PEBP1) from human. It is reactive with human and mouse. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HCNP | HCNPpp | PBP | PEBP1 | Prostatic binding protein | Raf kinase inhibitor protein | Raf kinase inhibitory protein | Prostatic-binding protein | Neuropolypeptide h3 | PEBP | PEBP-1 | RKIP
- Recommended Dilution: IHC-P
- 1 - 2 µg/ml
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P30086
- NCBI GenBank
- NM_002567 | NP_002558.1
- SwissProt
- P30086
Target
- Target
- Human PEBP1 / RKIP
- Antigen Species
- Human
- Gene Name
- PEBP1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids DHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQ were used as the immunogen for the RKIP antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS