
PEA3 / ETV4 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490372-100
Catalog Number: LS-C490372
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ETV4 antibody LS-C490372 is an unconjugated rabbit polyclonal antibody to ETV4 (PEA3) from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ETS translocation variant 4 | ETV4 | E1A-F | E1AF | Ets variant 4 | PEA3 | Protein PEA3 | PEAS3
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- P43268
- NCBI GenBank
- AAD09186.1 | AF095890
- SwissProt
- P43268
Target
- Target
- Human PEA3 / ETV4
- Antigen Species
- Human
- Gene Name
- ETV4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD of human PEA3/ETV4 were used as the immunogen for the ETV4 antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
