Pea3 antibody Western blot. All lanes: Anti Pea3 at 0.5 ug/ml. Lane 1: Rat Lung Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Lane 4: SW620 Whole Cell Lysate at 40 ug. Predicted band size: 68 kD. Observed band size: 68 kD.
PEA3 / ETV4 Antibody (aa1-41)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407911-100
Catalog Number: LS-C407911
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ETV4 antibody LS-C407911 is an unconjugated rabbit polyclonal antibody to ETV4 (PEA3) (aa1-41) from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ETS translocation variant 4 | ETV4 | E1A-F | E1AF | Ets variant 4 | PEA3 | Protein PEA3 | PEAS3
- UniProt Number
- P43268
- NCBI GenBank
- AAD09186.1 | AF095890
- SwissProt
- P43268
Target
- Target
- Human PEA3 / ETV4
- Antigen Species
- Human
- Gene Name
- ETV4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Pea3 (1-41 aa MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD), different from the related mouse sequence by seven amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl