Western blot analysis of extracts of various cell lines, using Pdha2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.
PDHA2 / PDH E1 Beta Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C749971-20
Catalog Number: LS-C749971
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PDH E1 Beta antibody LS-C749971 is an unconjugated rabbit polyclonal antibody to PDH E1 Beta (PDHA2) from mouse. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- PDHE1-A type II | PDHA2 | PDHAL
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P29803
- NCBI GenBank
- NP_005381.1
- SwissProt
- P29803
Target
- Target
- Mouse PDHA2 / PDH E1 Beta
- Antigen Species
- Mouse
- Gene Name
- PDHA2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 300 to the C-Terminus of mouse PDHA2 (NP_032837.1). ISYRSREEVHNVRSKSDPIMLLRERIISNNLSNIEELKEIDADVKKEVEDAAQFATTDPEPAVEDIANYLYHQDPPFEVRGAHKWLKYKSHS
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS