Human Apolipoprotein H Antibody (IgA) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67373-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot testing of 1) rat brain and 2) mouse brain with PDGF beta antibody at 0.5ug/ml. Predicted molecular weight ~27 kDa.
PDGF-BB Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782773-100
Catalog Number: LS-C782773
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PDGF-BB antibody LS-C782773 is an unconjugated rabbit polyclonal antibody to PDGF-BB from mouse. It is reactive with mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Ms, Rt
- Predicted Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- PDGF-BB | PDGF-b | PDGFB | SSV | PDGF subunit B | PDGF-2 | PDGF2 | Proto-oncogene c-Sis | SIS | C-sis | PDGF, B chain
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P01127
- NCBI GenBank
- NM_002608, NP_002599.1
- SwissProt
- P01127
Target
- Target
- Mouse PDGF-BB
- Antigen Species
- Ms
- Gene Name
- PDGFB
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Hu
Immunogen
- Immunogen
- Amino acids 89-129 (AEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQR) from the human protein were used as the immunogen for the PDGF beta antibody.
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
