Western blot - Anti-PDGF beta Picoband Antibody

PDGF-BB Antibody

Name: PDGF-BB Antibody
Brand: LSBio
SKU: LS-C661957-100
Price: 480 USD
Availability: InStock

$480.00each

Catalog Number: LS-C661957-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: PDGF-BB antibody LS-C661957 is an unconjugated rabbit polyclonal antibody to human PDGF-BB. Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: PDGF-BB | PDGF-b | PDGFB | SSV | PDGF subunit B | PDGF-2 | PDGF2 | Proto-oncogene c-Sis | SIS | C-sis | PDGF, B chain
UniProt Number: P01127
NCBI GenBank: NM_002608 | NP_002599.1
SwissProt: P01127

Target: Human PDGF-BB
Antigen Species: Human
Epitope: Expressed at high levels in the heart, brain (sustantia nigra), placenta and fetal kidney. Expressed at moderate levels in the brain (hippocampus), skeletal muscle, kidney and lung. .
Gene Name: PDGFB

Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human PDGF beta (89-129 aa AEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQR), different from the related mouse and rat sequences by three amino acids.
Immunogen Type: Synthetic Peptide (Linear)

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Preservative: Yes
Purification Method: Affinity Purified

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl