Western blot analysis of extracts of various cell lines, using PDE7B antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

PDE7B Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C747313-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: PDE7B antibody LS-C747313 is an unconjugated rabbit polyclonal antibody to PDE7B from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: BA472E5.1 | Phosphodiesterase 7B | PDE7B
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q9NP56
NCBI GenBank: NM_018945 | NP_061818.1
SwissProt: Q9NP56

Target

Target: Human PDE7B
Antigen Species: Human
Gene Name: PDE7B

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 341-450 of human PDE7B (NP_061818.1). VCEEFYRQGELEQKFELEISPLCNQQKDSIPSIQIGFMSYIVEPLFREWAHFTGNSTLSENMLGHLAHNKAQWKSLLPRQHRSRGSSGSGPDHDHAGQGTESEEQEGDSP
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)