Western blot analysis of extracts of various cells.

PCDHA12 Antibody

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C410036-20

Unit Size

Quantity

For bulk orders or custom formulations:

Description: PCDHA12 antibody LS-C410036 is an unconjugated rabbit polyclonal antibody to PCDHA12 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Application: IHC, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: PCDH-ALPHA12 | PCDHA12 | PCDH-alpha-12 | KIAA0345-like 2 | Protocadherin alpha 12 | Protocadherin alpha-12
Recommended Dilution: IHC: 1:50 - 1:100
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q9UN75
NCBI GenBank: NM_018903 | NP_061726.1
SwissProt: Q9UN75

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 713-792 of human PCDHA12 (NP_114070.1). LTLLLYTALRCSAPPTVSRCAPGKPTLVCSSAVGSWSYSQQRRQRVCSAESPPKTDLMAFSPSLQLSREDCLNPPSEVSY
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)