Western blot testing of 1) human placenta 2) human U-2 OS, 3) human HeLa, 4) rat brain, 5) rat lung, 6) mouse brain, 7) mouse lung, 8) mouse kidney, 9) mouse spleen and 10) mouse Neuro-2a lysate with PCDH15 antibody at 0.5ug/ml. Isoforms have been observed with molecular weights of: 250, 180, 160, 130, 90 and 60 kDa.

PCDH15 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782857-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: PCDH15 antibody LS-C782857 is an unconjugated rabbit polyclonal antibody to PCDH15 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Application: IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Ames waltzer | CDHR15 | DFNB23 | Nmf19 | Protocadherin-related 15 | USH1F | Usher syndrome 1F | PCDH15 | Protocadherin 15 | Protocadherin-15
Recommended Dilution: IHC-P: 1 - 2 µg/ml
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: Q96QU1
NCBI GenBank: NM_033056 | NP_149045.3
SwissProt: Q96QU1

Target

Target: Human PCDH15
Antigen Species: Human
Gene Name: PCDH15

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids DLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQ were used as the immunogen for the PCDH15 antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: 1X PBS