Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot testing of human SW579 cell lysate with PAX8 antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa but also observed at 55-60 kDa.
PAX8 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782058-100
Catalog Number: LS-C782058
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PAX8 antibody LS-C782058 is an unconjugated rabbit polyclonal antibody to human PAX8. Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Paired box 8 | Paired domain gene 8 | PAX8 | Paired box gene 8 | Paired box protein Pax-8
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- Q06710
- NCBI GenBank
- NM_003466 | NP_003457.1
- SwissProt
- Q06710
Target
- Target
- Human PAX8
- Antigen Species
- Human
- Gene Name
- PAX8
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids RKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQ from the human protein were used as the immunogen for the PAX8 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
