Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Pax2 antibody Western blot. All lanes: Anti Pax2 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Lung Tissue Lysate at 50 ug. Predicted band size: 45 kD. Observed band size: 45 kD.
PAX2 Antibody (aa248-282)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Dog, Guinea Pig, Hamster, Horse, Human, Mammal (Other), Mouse, Pig, Rabbit, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407946-100
Catalog Number: LS-C407946
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PAX2 antibody LS-C407946 is an unconjugated rabbit polyclonal antibody to PAX2 (aa248-282) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, GP, Ham, Hr, Hu, Mml, Ms, Por, Rb, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Paired box homeotic gene 2 | Paired box protein Pax-2 | PAPRS | Paired box 2 | Paired box gene 2 | PAX2
- UniProt Number
- Q02962
- NCBI GenBank
- NM_003987 | NP_003978.2
- SwissProt
- Q02962
Target
- Target
- Human PAX2
- Antigen Species
- Human
- Epitope
- Expressed in primitive cells of the kidney, ureter, eye, ear and central nervous system.
- Gene Name
- PAX2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Pax2 (248-282 aa RKHLRADTFTQQQLEALDRVFERPSYPDVFQASEH), identical to the related mouse sequence.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
