Human Colon: Formalin-Fixed, Paraffin-Embedded (FFPE)

PathPlus™ TFF3 / Trefoil Factor 3 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse
Format:	Liquid

$383.00each

Catalog Number: LS-B14380-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: Trefoil Factor 3 antibody LS-B14380 is an unconjugated rabbit polyclonal antibody to Trefoil Factor 3 (TFF3) from human. It is reactive with human and mouse. Validated for IHC and WB.
Application: IHC, IHC-P, WB
Reactivity: Hu, Ms
Intended Use: Research Use Only
Guarantees: This product carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: HP1.B | Intestinal trefoil factor | HITF | ITF | TFI | p1B | Polypeptide P1.B | TFF3 | Trefoil factor 3 | Trefoil factor 3 (intestinal)
Recommended Dilution: IHC: 1:50 - 1:200
Recommended Dilution: IHC-P: 1:200
Recommended Dilution: WB: 1:500 - 1:2000
NCBI GenBank: NM_003226

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-94 of human TFF3 (NP_003217.3). MLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)