Polyclonal Chicken GFP Antibody (clone IQGFP6 Polyclonal, WB)
Catalog Number: LS-C827997-50
50 µL (1 mg/mL) / $492.00
Antibody: Chicken Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay, Western Blot
Format: Liquid
Human Heart: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:200.
PathPlus™ Polyclonal Rabbit anti-Human CD36 Antibody (IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$383.00each
Catalog Number: LS-B15329-50
Catalog Number: LS-B15329
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CD36 antibody LS-B15329 is an unconjugated rabbit polyclonal antibody to CD36 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This product carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Cluster determinant 36 | FAT | Fatty acid translocase | Glycoprotein IIIb | gp4 | GPIIIB | GPIV | PAS-4 protein | PAS IV | PASIV | Platelet collagen receptor | Platelet glycoprotein IV | SCARB3 | Thrombospondin receptor | BDPLT10 | CD36 | CD36 antigen | CHDS7 | gp3B | PAS-4 | Platelet glycoprotein 4
- Recommended Dilution: IHC-P
- 1:200
- UniProt Number
- P16671
- NCBI GenBank
- NM_000072 | NP_000063.2
- SwissProt
- P16671
Target
- Target
- CD36
- Antigen Species
- Human
- Specificity
- Human CD36
- Epitope
- Human CD36
- Gene Name
- CD36
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 301-400 of human CD36 (NP_001120916.1). ASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQ
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 50 Microliter
- Animal Free
- No
- Carrier-Free
- Yes
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
