Human Prostate: Formalin-Fixed, Paraffin-Embedded (FFPE)

PathPlus™ MSMB / MSP Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse
Format:	Liquid

$383.00each

Catalog Number: LS-B16774-50

Unit Size

Quantity

For bulk orders or custom formulations:

Description: MSP antibody LS-B16774 is an unconjugated rabbit polyclonal antibody to MSP (MSMB) from human. It is reactive with human and mouse. Validated for IHC and WB.
Application: IHC, IHC-P, WB
Reactivity: Hu, Ms
Intended Use: Research Use Only
Guarantees: This product carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Beta-microseminoprotein | HPC13 | Microseminoprotein, beta- | MSP | MSPB | MSMB | PN44 | PSP57 | Seminal plasma beta-inhibin | PSP | PSP-94 | PSP94 | IGBF | Immunoglobulin binding factor | Immunoglobulin-binding factor | PRPS | PRSP
Recommended Dilution: IHC-P: 5 µg/ml
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: P08118
NCBI GenBank: NM_002443 | NP_002434.1
SwissProt: P08118

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-114 of human MSMB (NP_002434.1). VPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)