
Western blot analysis of extracts of rat skeletal muscle, using PARD6A antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 15s.
PARD6A / PAR6 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C747834-20
Catalog Number: LS-C747834
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PAR6 antibody LS-C747834 is an unconjugated rabbit polyclonal antibody to PAR6 (PARD6A) from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- PAR-6 alpha | PARD6A | PAR6A | Tax interaction protein 40 | Tax-interacting protein 40 | PAR-6 | PAR-6A | PAR6C | TIP-40 | PAR6 | PAR6alpha | TAX40
- UniProt Number
- Q9NPB6
- NCBI GenBank
- NM_016948 | NP_058644.1
- SwissProt
- Q9NPB6
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 1:500 - 1:2000 |
Target
- Target
- Human PARD6A / PAR6
- Antigen Species
- Human
- Gene Name
- PARD6A
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 256-345 of human PARD6A (NP_001032358.1). RGASGRLTGPPSAGPGPAEPDSDDDSSDLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFSL
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
