PAL / PAM Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C750051-20
Catalog Number: LS-C750051
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PAM antibody LS-C750051 is an unconjugated rabbit polyclonal antibody to PAM (PAL) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- PAL | PAM | Peptidylglycine 2-hydroxylase | Peptidylamidoglycolate lyase | PHM
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P19021
- NCBI GenBank
- NM_000919 | NP_000910.2
- SwissProt
- P19021
Target
- Target
- Human PAL / PAM
- Antigen Species
- Human
- Gene Name
- PAM
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 800 to the C-Terminus of human PAM (NP_620176.1). GRVLGRFRGKGSGGLNLGNFFASRKGYSRKGFDRLSTEGSDQEKEDDGSESEEEYSAPLPALAPSSS
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS