PACE4 antibody Western blot. All lanes: Anti PACE4 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: 293T Whole Cell Lysate at 40 ug. Predicted band size: 80 kD, 45/80/100 kD. Observed band size: 80 kD, 45/80/100 kD.
PACE4 / PCSK6 Antibody (aa614-651)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rabbit, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407980-100
Catalog Number: LS-C407980
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PCSK6 antibody LS-C407980 is an unconjugated rabbit polyclonal antibody to PCSK6 (PACE4) (aa614-651) from human. It is reactive with human, rat and rabbit. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rb, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- PACE4 | PCSK6 | SPC4
- UniProt Number
- P29122
- NCBI GenBank
- NM_002570 | NP_002561.1
- SwissProt
- P29122
Target
- Target
- Human PACE4 / PCSK6
- Antigen Species
- Human
- Epitope
- Each PACE4 isoform exhibits a unique restricted distribution. Isoform PACE4A-I is expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, but at comparatively higher levels in the liver. Isoform PACE4A-II is at least expressed in placenta. Isoform PACE4B was only found in the embryonic kidney cell line from which it was isolated. Isoform PACE4C and isoform PACE4D are expressed in placenta. Isoform PACE4E-I is expressed in cerebellum, placenta and pituitary. Isoform PACE4E-II is at least present in cerebellum.
- Gene Name
- PCSK6
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human PACE4 (614-651 aa RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE), different from the related rat sequence by two amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl