Western blot - Anti-EBP1 Picoband Antibody

PA2G4 / EBP1 Antibody

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human
Format:	Lyophilized

$480.00each

Catalog Number: LS-C662165-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: EBP1 antibody LS-C662165 is an unconjugated rabbit polyclonal antibody to human EBP1 (PA2G4). Validated for IHC and WB.
Application: IHC, IHC-P, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ErbB-3 binding protein 1 | EBP1 | ErbB3-binding protein 1 | ErbB3-binding protein Ebp1 | p38-2G4 | HG4-1 | PA2G4
UniProt Number: Q9UQ80
NCBI GenBank: NM_006191 | NP_006182.2
SwissProt: Q9UQ80

Target: Human PA2G4 / EBP1
Antigen Species: Human
Epitope: Isoform 2 is undetectable whereas isoform 1 is strongly expressed in cancer cells (at protein level). Isoform 1 and isoform 2 are widely expressed, including heart, brain, lung, pancreas, skeletal muscle, kidney, placenta and liver. .
Gene Name: PA2G4

Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human EBP1 (138-178 aa RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN), identical to the related mouse and rat sequences.
Immunogen Type: Synthetic Peptide (Linear)

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at: technical@vectorlabs.com.