Western blot analysis of extracts of various cell lines, using CDKN2A antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
p16INK4a / CDKN2A Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C746943-20
Catalog Number: LS-C746943
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CDKN2A antibody LS-C746943 is an unconjugated rabbit polyclonal antibody to CDKN2A (p16INK4a) from human. It is reactive with human and mouse. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- INK4A | Multiple tumor suppressor 1 | MTS-1 | MTS1 | p16-INK4A | p16 INK4A | p16INK4A | CDKN2A | cyclin-dependent kinase inhibitor 2A
- Recommended Dilution: IHC
- 1:50 - 1:100
- Recommended Dilution: WB
- 1:200 - 1:500
Target
- Target
- Human p16INK4a / CDKN2A
- Antigen Species
- Human
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 20 to the C-Terminus of human CDKN2A (XP_005251400.1). NCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS