Western blot testing of Otx2 antibody and COLO320 lysate. Predicted/observed size ~32KD

OTX2 Antibody (aa266-296)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Bovine, Chicken, Dog, Hamster, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Xenopus
Format:	Lyophilized

$587.00each

Catalog Number: LS-C389076-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: OTX2 antibody LS-C389076 is an unconjugated rabbit polyclonal antibody to OTX2 (aa266-296) from human. It is reactive with human, mouse, rat and other species. Validated for WB.
Application: WB
Reactivity: Bov, Can, Ck, Ham, Hr, Hu, Ms, Por, Rb, Rt, Sh, Xen
Predicted Reactivity: Zebrafish
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: CPHD6 | Homeobox protein OTX2 | MCOPS5 | Orthodenticle homeobox 2 | Orthodenticle homolog 2 | OTX2
UniProt Number: P32243
NCBI GenBank: NM_021728 | NP_068374.1
SwissProt: P32243

Immunogen: Synthetic peptide from the C-Terminus of human Orthodenticle homeobox 2 (DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL). Percent identity by BLAST analysis: Human, Mouse, Rat, Ferret, Sheep, Cat, Bovine, Hamster, Elephant, Rabbit, Horse, Pig, Opossum, Chicken, Xenopus, Dog (100%); Trout, Medaka, Pufferfish (97%); Lizard, Newt, Zebrafish (94%); Stickleback (90%).
Immunogen Type: Synthetic Peptide (Linear)

Storage Conditions: Prior to reconstitution, 4°C. Following reconstitution store at -20°C. Avoid freeze-thaw cycles.
Recommended Storage Buffer: PBS