Otoferlin antibody Western blot. All lanes: Anti Otoferlin at 0.5 ug/ml. Lane 1: Rat Cardiac Muscle Tissue Lysate at 50 ug. Lane 2: 293T Whole Cell Lysate at 40 ug. Predicted band size: 227 kD. Observed band size: 227 kD.
OTOF / Otoferlin Antibody (aa1831-1863)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407830-100
Catalog Number: LS-C407830
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Otoferlin antibody LS-C407830 is an unconjugated rabbit polyclonal antibody to Otoferlin (OTOF) (aa1831-1863) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AUNB1 | DFNB6 | DFNB9 | OTOF | Otoferlin | Fer-1-like protein 2 | FER1L2 | NSRD9
- UniProt Number
- Q9HC10
- NCBI GenBank
- NM_004802 | NP_004793.2
- SwissProt
- Q9HC10
Target
- Target
- Human OTOF / Otoferlin
- Antigen Species
- Human
- Epitope
- Isoform 1 and isoform 3 are found in adult brain. Isoform 2 is expressed in the fetus and in adult brain, heart, placenta, skeletal muscle and kidney.
- Gene Name
- OTOF
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Otoferlin (1831-1863 aa QIWDADHFSADDFLGAIELDLNRFPRGAKTAKQ), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl