Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot testing of 1) rat liver and 2) mouse liver lysate with OTC antibody at 0.5ug/ml. Predicted molecular weight ~40 kDa.
OTC Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781940-100
Catalog Number: LS-C781940
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- OTC antibody LS-C781940 is an unconjugated rabbit polyclonal antibody to OTC from mouse. It is reactive with mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Ms, Rt
- Predicted Reactivity
- Human
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- OCTD | Ornithine carbamoyltransferase | Ornithine transcarbamylase | OTC | OTCase
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P00480
- NCBI GenBank
- NM_000531 | NP_000522.3
- SwissProt
- P00480
Target
- Target
- Mouse OTC
- Antigen Species
- Mouse
- Gene Name
- OTC
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 33-70 (NKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK) from the human protein were used as the immunogen for the OTC antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
