OPRS1 / SIGMAR1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C749820-20
Catalog Number: LS-C749820
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SIGMAR1 antibody LS-C749820 is an unconjugated rabbit polyclonal antibody to SIGMAR1 (OPRS1) from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HSigmaR1 | ALS16 | SIG-1R | Sigma 1-type opioid receptor | SR-BP | Opioid receptor, sigma 1 | OPRS1 | Sigma1-receptor | SIGMAR1 | SR31747-binding protein | SRBP | Sigma1R | SR-BP1 | SR31747 binding protein 1
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q99720
- NCBI GenBank
- NM_005866 | NP_005857.1
- SwissProt
- Q99720
Target
- Target
- Human OPRS1 / SIGMAR1
- Antigen Species
- Human
- Gene Name
- SIGMAR1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 31-80 of human SIGMAR1 (NP_005857.1). GTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQ
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS