
Immunohistochemistry of paraffin-embedded rat testis using OPRK1 antibody at dilution of 1:100 (40x lens).
OPRK1 / Kappa Opioid Receptor Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C749050-20
Catalog Number: LS-C749050
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Kappa Opioid Receptor antibody LS-C749050 is an unconjugated rabbit polyclonal antibody to Kappa Opioid Receptor (OPRK1) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Kappa-type opioid receptor | Opiate receptor, kappa-1 | K-OR-1 | KOR | Opioid receptor, kappa 1 | OPRK | Ork1 | Kappa opioid receptor | KOR-1 | Opioid receptor kappa | OPRK1
- UniProt Number
- P41145
- NCBI GenBank
- NM_000912 | NP_000903.2
- SwissProt
- P41145
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC | 1:50 - 1:200 |
| WB | 1:500 - 1:2000 |
Target
- Target
- Human OPRK1 / Kappa Opioid Receptor
- Antigen Species
- Human
- Gene Name
- OPRK1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 300 to the C-Terminus of human OPRK1 (NP_000903.2). GSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRVRNTVQDPAYLRDIDGMNKPV
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
