Western blot analysis of extracts of rat brain cells.
OPRD1 / Delta Opioid Receptor Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409980-20
Catalog Number: LS-C409980
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Delta Opioid Receptor antibody LS-C409980 is an unconjugated rabbit polyclonal antibody to mouse Delta Opioid Receptor (OPRD1). Validated for WB.
- Application
- WB
- Reactivity
- Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- D-OR-1 | Delta-type opioid receptor | Delta opioid receptor | Delta opiate receptor | Delta opioid receptor 1 | Delta-1 opioid receptor | Opioid delta receptor | OPRD1 | DOR-1 | Opioid receptor, delta 1 | OPRD
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P41143
- NCBI GenBank
- NM_000911 | NP_000902.3
- SwissProt
- P41143
Target
- Target
- Human OPRD1 / Delta Opioid Receptor
- Antigen Species
- Human
- Epitope
- Human OPRD1 / Delta Opioid Receptor
- Gene Name
- OPRD1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 300 to the C-Terminus of human OPRD1 (NP_000902.3). LHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS