OGT antibody Western blot. All lanes: Anti OGT at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Mouse Brain Tissue Lysate at 50 ug. Lane 3: Mouse Cardiac Muscle Tissue Lysate at 50 ug. Lane 4: A549 Whole Cell Lysate at 40 ug. Predicted band size: 117 kD. Observed band size: 117 kD.
OGT / O-GLCNAC Antibody (aa1008-1046)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Dog, Guinea Pig, Horse, Human, Mammal (Other), Mouse, Pig, Rabbit, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407979-100
Catalog Number: LS-C407979
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- O-GLCNAC antibody LS-C407979 is an unconjugated rabbit polyclonal antibody to O-GLCNAC (OGT) (aa1008-1046) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, GP, Hr, Hu, Mml, Ms, Por, Rb, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HRNT1 | O-GLCNAC | OGT
- UniProt Number
- O15294
- NCBI GenBank
- AAB63466.1 | U77413
- SwissProt
- O15294
Target
- Target
- Human OGT / O-GLCNAC
- Antigen Species
- Human
- Epitope
- Highly expressed in pancreas and to a lesser extent in skeletal muscle, heart, brain and placenta. Present in trace amounts in lung and liver. .
- Gene Name
- OGT
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human OGT (1008-1046 aa NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl