OGT antibody Western blot. All lanes: Anti OGT at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Mouse Brain Tissue Lysate at 50 ug. Lane 3: Mouse Cardiac Muscle Tissue Lysate at 50 ug. Lane 4: A549 Whole Cell Lysate at 40 ug. Predicted band size: 117 kD. Observed band size: 117 kD.

OGT / O-GLCNAC Antibody (aa1008-1046)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Bovine, Dog, Guinea Pig, Horse, Human, Mammal (Other), Mouse, Pig, Rabbit, Rat, Sheep
Format:	Lyophilized

See all Human OGT / O-GLCNAC Antibodies →

$480.00each

Catalog Number: LS-C407979-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: O-GLCNAC antibody LS-C407979 is an unconjugated rabbit polyclonal antibody to O-GLCNAC (OGT) (aa1008-1046) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
Application: IHC, IHC-P, WB
Reactivity: Bov, Can, GP, Hr, Hu, Mml, Ms, Por, Rb, Rt, Sh
Intended Use: RUO
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: HRNT1 | O-GLCNAC | OGT
UniProt Number: O15294
NCBI GenBank: AAB63466.1, U77413
SwissProt: O15294

Target

Target: Human OGT / O-GLCNAC
Antigen Species: Hu
Epitope: Highly expressed in pancreas and to a lesser extent in skeletal muscle, heart, brain and placenta. Present in trace amounts in lung and liver. .
Gene Name: OGT

Antibody

Host Species: Rb
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human OGT (1008-1046 aa NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA), identical to the related mouse and rat sequences.
Immunogen Type: SP-Lin

Format

Conjugate/Label: Unconj
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: AP

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl