Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot testing of rat 1) spleen, 2) thymus, 3) liver and 4) testis lysate with OGG1 antibody at 0.5ug/ml. Predicted molecular weight ~39 kDa.
OGG1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782055-100
Catalog Number: LS-C782055
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- OGG1 antibody LS-C782055 is an unconjugated rabbit polyclonal antibody to OGG1 from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 8-oxoguanine DNA glycosylase | AP lyase | HMMH | N-glycosylase/DNA lyase | HOGG1 | OGH1 | OGG1 type 1f | MMH | MUTM | OGG1
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- O15527
- NCBI GenBank
- NM_016819 | NP_058212.1
- SwissProt
- O15527
Target
- Target
- Human OGG1
- Antigen Species
- Human
- Gene Name
- OGG1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids KYFQLDVTLAQLYHHWGSVDSHFQEVAQKFQGVRLLRQD from the human protein were used as the immunogen for the OGG1 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
