Western blot analysis of TrkA using anti-TrkA antibody
NTRK1 / TrkA Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662930-100
Catalog Number: LS-C662930
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TrkA antibody LS-C662930 is an unconjugated rabbit polyclonal antibody to human TrkA (NTRK1). Validated for WB.
- Application
- IHC, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Oncogene TRK | TrkA/NGF receptor | Tropomyosin-related kinase A | TRK | TRK1 | Tyrosine kinase receptor | Tyrosine kinase receptor A | gp140trk | MTC | NTRK1 | p140-TrkA | Trk-A | TRKA
- UniProt Number
- P04629
- NCBI GenBank
- NM_002529 | NP_002520.2
- SwissProt
- P04629
Target
- Target
- Human NTRK1 / TrkA
- Antigen Species
- Human
- Epitope
- Isoform TrkA-I is found in most non-neuronal tissues. Isoform TrkA-II is primarily expressed in neuronal cells. TrkA-III is specifically expressed by pluripotent neural stem and neural crest progenitors.
- Gene Name
- NTRK1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human TrkA (EVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVL).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl