
NR4A1 / NUR77 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490440-100
Catalog Number: LS-C490440
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- NUR77 antibody LS-C490440 is an unconjugated rabbit polyclonal antibody to NUR77 (NR4A1) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- GFRP1 | Early response protein NAK1 | HMR | NGFIB | Orphan nuclear receptor TR3 | Orphan receptor tr3 | Steroid receptor TR3 | TR3 | NAK1 | NGFI-B | NP10 | NR4A1 | Receptor NGFIB | Testicular receptor 3 | TR3 orphan receptor | N10 | NAK-1 | NUR77 | Orphan nuclear receptor HMR
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- P22736
- NCBI GenBank
- NM_002135 | NP_002126.2
- SwissProt
- P22736
Target
- Target
- Human NR4A1 / NUR77
- Antigen Species
- Human
- Gene Name
- NR4A1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids HLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYD of human NUR77 were used as the immunogen for the NUR77 antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
