Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
NQO1 antibody Western blot. All lanes: Anti NQO1 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Lung Tissue Lysate at 50 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Lane 4: A549 Whole Cell Lysate at 40 ug. Lane 5: MM231 Whole Cell Lysate at 40 ug. Lane 6: SW620 Whole Cell Lysate at 40 ug. Lane 7: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.
NQO1 Antibody (aa242-274)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407709-100
Catalog Number: LS-C407709
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- NQO1 antibody LS-C407709 is an unconjugated rabbit polyclonal antibody to NQO1 (aa242-274) from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Azoreductase | DHQU | DT-diaphorase | Dioxin-inducible 1 | DIA4 | Diaphorase-4 | NAD(P)H:quinone oxireductase | Phylloquinone reductase | QR1 | Menadione reductase | NMOR1 | NMORI | NQO1 | DTD | Quinone reductase 1
- UniProt Number
- P15559
- NCBI GenBank
- NM_000903 | NP_000894.1
- SwissProt
- P15559
Target
- Target
- Human NQO1
- Antigen Species
- Human
- Gene Name
- NQO1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human NQO1 (242-274 aa EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK), different from the related mouse and rat sequences by five amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
