
NPPB / BNP Antibody (aa1-32, clone 17-16)
Primary AntibodyLSBio Guarantee
| Antibody: | Mouse Monoclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay |
| Reactivity: | Human |
| Format: | Lyophilized |
$490.00each
Catalog Number: LS-C127098-10
Catalog Number: LS-C127098
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- BNP antibody LS-C127098 is an unconjugated mouse monoclonal antibody to human BNP (NPPB) (aa1-32). Validated for ELISA.
- Application
- ELISA
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Monoclonal Antibodies
- Alternative Names
- BNP | Natriuretic peptides B | Natriuretic peptide B | Natriuretic protein | Brain type natriuretic peptide | NPPB
- UniProt Number
- P16860
- NCBI GenBank
- NM_002521|NP_002512.1
- SwissProt
- P16860
Target
- Target
- Human NPPB / BNP
- Antigen Species
- Human
- Epitope
- Recognizes synthetic human Brain Natriuretic Peptide (aa 1-32).
- Gene Name
- NPPB
Antibody
- Host Species
- Mouse
- Clonality
- Monoclonal
- Clone
- 17-16
- Isotype
- IgG1
- Origin Species
- Human
Immunogen
- Immunogen
- Synthetic human BNP (aa 1-32) KLH conjugated (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH). Percent identity by BLAST analysis: Human, Gibbon (100%).
- Immunogen Type
- Synthetic Immunogen
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, pH 7.2
- Preservative
- No
- Purification Method
- Protein G Affinity
Storage & Handling
- Storage Conditions
- Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 1 year at -20°C.
- Recommended Storage Buffer
- PBS
