
NPPA / ANP Antibody (aa1-30)
Primary AntibodyLSBio Guarantee
| Antibody: | Sheep Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay, Radioimmunoassay |
| Reactivity: | Human |
| Format: | Lyophilized |
$441.00each
Catalog Number: LS-C126932-20
Catalog Number: LS-C126932
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ANP antibody LS-C126932 is an unconjugated sheep polyclonal antibody to human ANP (NPPA) (aa1-30). Validated for ELISA and RIA.
- Application
- ELISA, RIA
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ANF | ANP | Atriopeptin | ATFB6 | Atrial natriuretic factor | CDD-ANF | Cardionatrin | Natriuretic peptides A | Prepronatriodilatin | NPPA | Natriuretic peptide A | PND | Natriuretic peptide precursor A
- UniProt Number
- P01160
- NCBI GenBank
- NM_006172|NP_006163.1
- SwissProt
- P01160
Target
- Target
- Human NPPA / ANP
- Antigen Species
- Human
- Epitope
- Recognizes synthetic human pro-Atrial Natriuretic Peptide (aa 1-30). There were no cross reactivities obtained with human pro-ANP.
- Gene Name
- NPPA
Antibody
- Host Species
- Sheep
- Clonality
- Polyclonal
- Origin Species
- Human
Immunogen
- Immunogen
- Synthetic human pro-ANP (aa 1-30) polylysine conjugated(NPMYNAVSNADLMDFKNLLDHLEEKMPLED). Percent identity by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Guinea pig (93%); Hamster (90%); Mouse, Rat, Dolphin, Panda, Cat, Pig (87%); Sheep, Elephant, Bovine, Rabbit (83%); Dog, Horse (80%).
- Immunogen Type
- Synthetic Immunogen
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized
- Volume
- 20 Microliter
- Preservative
- No
- Purification Method
- Unpurified (Serum / Ascites / Supernatant)
Storage & Handling
- Storage Conditions
- Lyophilized powder may be stored at -20°C. Stable for 1 year at -20°C. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Reconstituted product is stable for 1 year at -20°C.
