
NPF / Neuropeptide F Antibody (Preservative Free, Biotin)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay |
| Reactivity: | Fruit Fly |
| Format: | Lyophilized |
$350.00each
Catalog Number: LS-C343297-50
Catalog Number: LS-C343297
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Neuropeptide F antibody LS-C343297 is a biotin-conjugated rabbit polyclonal antibody to fruit fly Neuropeptide F (NPF). Validated for ELISA.
- Application
- ELISA
- Reactivity
- Dros
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
Recommended Dilution
| Application | Dilution |
|---|---|
| ELISA | 1:1000 - 1:5000 |
Target
- Target
- Fruit fly NPF / Neuropeptide F
- Antigen Species
- Fruit Fly
- Epitope
- The rabbit anti-Drosophila Neuropeptide F antibody shows strong binding to the synthetic immunogen. Its binding activity to native protein or cross reactivity with the protein derived from other species was not tested.
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Synthetic peptide derived from Drosophila Neuropeptide F. Immunogen Sequence: CSNSRPPRKNDVNTMADAYKFLQDLDTYYGDRARVRF.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Biotin
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, No preservatives added
- Preservative
- No
- Purification Method
- Protein A/G Affinity
Storage & Handling
- Storage Conditions
- Short term: Store at 4 °C for 1 month. Long term: Store at -20°C to -70°C for up to 1 year. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
