Western blot testing of human HeLa cell lysate with iNOS antibody at 0.5ug/ml. Predicted molecular weight ~130 kDa.
NOS2 / iNOS Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782794-100
Catalog Number: LS-C782794
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- INOS antibody LS-C782794 is an unconjugated rabbit polyclonal antibody to human iNOS (NOS2). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Hepatocyte NOS | HEP-NOS | Inducible NOS | NOS, type II | NOS type II | Inducible NO synthase | NOS2 | NOS2A | INOS | NOS
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P35228
- NCBI GenBank
- NM_000625 | NP_000616.3
- SwissProt
- P35228
Target
- Target
- Human NOS2 / iNOS
- Antigen Species
- Human
- Gene Name
- NOS2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 1088-1126 (ARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHED) from the human protein were used as the immunogen for the iNOS antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS