Western blot - Anti-iNOS Picoband Antibody
NOS2 / iNOS Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C661961-100
Catalog Number: LS-C661961
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- INOS antibody LS-C661961 is an unconjugated rabbit polyclonal antibody to human iNOS (NOS2). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Hepatocyte NOS | HEP-NOS | Inducible NOS | NOS, type II | NOS type II | Inducible NO synthase | NOS2 | NOS2A | INOS | NOS
- UniProt Number
- P35228
- NCBI GenBank
- NM_000625 | NP_000616.3
- SwissProt
- P35228
Target
- Target
- Human NOS2 / iNOS
- Antigen Species
- Human
- Epitope
- Expressed in the liver, retina, bone cells and airway epithelial cells of the lung. Not expressed in the platelets.
- Gene Name
- NOS2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human iNOS (1088-1126 aa ARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHED), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl